Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Instagram

Instagram Gallery Not Enabled

Popular Products
Each pen I make is individual, and as it is made from natural wood the grain will be different.

Unless I specifically say in the description, the pen you receive may differ slightly from the picture.

If you want a specific pen made I can usually do this, and often can then email you a picture of the actual pen before you commit to it - I will say if you are asking for a particularly rare wood however that I need to go out and buy. There are some really exotic and rare woods that make great and unusual pens so please contact me and I will see what I can do.

As a further bespoke service I have started to make pens out of clients own wood - for instance I am making a set of pens for a Scottish client who owns a forest of Douglas Fir! But often client wood needs dried out so takes some time - sometimes months - before its ready.

Just try me out.




Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract