Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Withdraw from contract

Withdraw from contract

Use this form to withdraw from your purchase within the withdrawal period. We will send you an email confirming receipt.

Please fill in your name, email address and order number.
Popular Products
Each pen I make is individual, and as it is made from natural wood the grain will be different.

Unless I specifically say in the description, the pen you receive may differ slightly from the picture.

If you want a specific pen made I can usually do this, and often can then email you a picture of the actual pen before you commit to it - I will say if you are asking for a particularly rare wood however that I need to go out and buy. There are some really exotic and rare woods that make great and unusual pens so please contact me and I will see what I can do.

As a further bespoke service I have started to make pens out of clients own wood - for instance I am making a set of pens for a Scottish client who owns a forest of Douglas Fir! But often client wood needs dried out so takes some time - sometimes months - before its ready.

Just try me out.




Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract